Lab #4: BLAST by Betty Berhanu
1. The protein I searched for is Escherichia coli (E. coli). It is a bacteria that normally lives in the intestines of healthy people and animals. There are some E. coli bacteria that cause no or little harm to us, and there some that are really harmful and cause severe abdominal cramp, bloody diarrhea, and vomiting. I chose this protein because we use this bacteria in many of our Biology classes and labs, and I am a little familiar with it.
2. The specific protein I chose is Escherichia coli strain 14EC017 plasmid p14EC017b.
3. The amino sequence is:
2. The specific protein I chose is Escherichia coli strain 14EC017 plasmid p14EC017b.
3. The amino sequence is:
MFKLKLLSISTIFILAGCVSLAPEYQRPPAPVPQQFSLSKNSLT
PAVNSYQDTGWRNFFVDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQ
LNASSGITYNGGLKGDKPTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARR
AVHILLVSNVSQSYFSQQLAYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQA
RGQIESTRAEIAKREGDLAQANNALQLVLGTYRALPSEKGMKGGEIAPVKLPPNLSSQ
ILLQRPDIMEAEYQLKAADANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWN
FIPKIEIPIFNAGRNKANLKLAEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQL
ESQQRYLDSLQITLQRARGLYASGAVSYIEVLDAERSLFATQQTILDLTYSRQVNEIN
LFTALGGGWVE
The first 10 amino acid: Methionine, Phenylalanine, Lysine, Leucine, Lysine, Leucine, Leucine, Serine, Isoleucine, and Serine.
4. Citation: Author: Li,B. and Wang,X. Title: mcr-1 positive E.coli isolates in China. Journal: Submitted (18-OCT-2017) Chinese Academy of Science, South China Sea
Institute of Oceanology, 164 Xingang West Rd, Guangzhou, Guangdong
510000, China
5. Nucleotide sequence:
1 ttaggtaaag tacccctatc aatactctgg acttcgtttg aaccatttac caggtctgcc 61 tgtacgagaa gcgttatgtt caaattaaaa ttactcagca tcagtaccat attcatcctg 121 gctggttgtg tttctctggc acctgaatat cagcgtccgc cagctccggt tccccagcag 181 ttttcattgt ctaaaaacag tctgacgcct gcggtaaaca gctatcagga tacgggctgg 241 cgaaactttt ttgtcgatcc ccaggtcagc aggctgatcg gtgaagccct gaataataac 301 cgtgatttga gaatggctgc cctgaaggtt gaagaggccc gggcccagtt caacgtcacg 361 gatgcagatc gttatcccca actgaatgcc tcatccggga tcacatacaa cggtggtctg 421 aaaggtgaca agccgaccac acaggagtac gacgcgggtc tggagctcag ctatgagctc 481 gatttttttg gcaaacttaa gaacatgagt gaggctgatc gccagaacta ctttgccagc 541 gaagaagccc gtcgtgccgt acacatcctg ctggtctcca acgtttcaca gagctatttc 601 agccagcaac tggcgtacga acaactccgt attgcgcggg aaacgctgaa aaattatgaa 661 cagtcctatg ctttcgttga gcaacagctc gtgaccggga gtacgaacgt tctggcactt 721 gaacaggcga gaggacaaat cgaaagtacc cgcgccgaaa tagccaaacg agaaggcgat 781 ctggctcagg caaacaatgc cctgcaactg gtgctgggaa cgtaccgcgc acttccgtca 841 gaaaaaggga tgaaaggcgg ggagatcgca ccagtaaaat tgccaccaaa tctatcttca

Hi Betty! Thank you for clarifying that not all forms of E. coli are harmful, I didn't now! I enjoyed reading your post!
ReplyDelete