Lab #4: BLAST by Betty Berhanu

1. The protein I searched for is Escherichia coli (E. coli). It is a bacteria that normally lives in the intestines of healthy people and animals. There are some E. coli bacteria that cause no or little harm to us, and there some that are really harmful and cause severe abdominal cramp, bloody diarrhea, and vomiting. I chose this protein because we use this bacteria in many of our Biology classes and labs, and I am a little familiar with it. 

2. The specific protein I chose is Escherichia coli strain 14EC017 plasmid p14EC017b. 

3. The amino sequence is: 
                     MFKLKLLSISTIFILAGCVSLAPEYQRPPAPVPQQFSLSKNSLT
                     PAVNSYQDTGWRNFFVDPQVSRLIGEALNNNRDLRMAALKVEEARAQFNVTDADRYPQ
                     LNASSGITYNGGLKGDKPTTQEYDAGLELSYELDFFGKLKNMSEADRQNYFASEEARR
                     AVHILLVSNVSQSYFSQQLAYEQLRIARETLKNYEQSYAFVEQQLVTGSTNVLALEQA
                     RGQIESTRAEIAKREGDLAQANNALQLVLGTYRALPSEKGMKGGEIAPVKLPPNLSSQ
                     ILLQRPDIMEAEYQLKAADANIGAARAAFFPSITLTSGLSASSTELSSLFTSGSGMWN
                     FIPKIEIPIFNAGRNKANLKLAEIRQQQSVVNYEQKIQSAFKDVSDTLALRDSLSQQL
                     ESQQRYLDSLQITLQRARGLYASGAVSYIEVLDAERSLFATQQTILDLTYSRQVNEIN
                     LFTALGGGWVE
   The first 10 amino acid: Methionine, Phenylalanine, Lysine, Leucine, Lysine, Leucine, Leucine, Serine, Isoleucine, and Serine. 

4. Citation: Author: Li,B. and Wang,X. Title: mcr-1 positive E.coli isolates in China. Journal: Submitted (18-OCT-2017) Chinese Academy of Science, South China Sea
            Institute of Oceanology, 164 Xingang West Rd, Guangzhou, Guangdong
            510000, China
5. Nucleotide sequence: 
        1 ttaggtaaag tacccctatc aatactctgg acttcgtttg aaccatttac caggtctgcc
       61 tgtacgagaa gcgttatgtt caaattaaaa ttactcagca tcagtaccat attcatcctg
      121 gctggttgtg tttctctggc acctgaatat cagcgtccgc cagctccggt tccccagcag
      181 ttttcattgt ctaaaaacag tctgacgcct gcggtaaaca gctatcagga tacgggctgg
      241 cgaaactttt ttgtcgatcc ccaggtcagc aggctgatcg gtgaagccct gaataataac
      301 cgtgatttga gaatggctgc cctgaaggtt gaagaggccc gggcccagtt caacgtcacg
      361 gatgcagatc gttatcccca actgaatgcc tcatccggga tcacatacaa cggtggtctg
      421 aaaggtgaca agccgaccac acaggagtac gacgcgggtc tggagctcag ctatgagctc
      481 gatttttttg gcaaacttaa gaacatgagt gaggctgatc gccagaacta ctttgccagc
      541 gaagaagccc gtcgtgccgt acacatcctg ctggtctcca acgtttcaca gagctatttc
      601 agccagcaac tggcgtacga acaactccgt attgcgcggg aaacgctgaa aaattatgaa
      661 cagtcctatg ctttcgttga gcaacagctc gtgaccggga gtacgaacgt tctggcactt
      721 gaacaggcga gaggacaaat cgaaagtacc cgcgccgaaa tagccaaacg agaaggcgat
      781 ctggctcagg caaacaatgc cctgcaactg gtgctgggaa cgtaccgcgc acttccgtca
      841 gaaaaaggga tgaaaggcgg ggagatcgca ccagtaaaat tgccaccaaa tctatcttca

Comments

  1. Hi Betty! Thank you for clarifying that not all forms of E. coli are harmful, I didn't now! I enjoyed reading your post!

    ReplyDelete

Post a Comment